Lineage for d2rdbb_ (2rdb B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 911704Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 911971Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)
  7. 911983Species Pseudomonas stutzeri [TaxId:316] [109791] (6 PDB entries)
    Uniprot O87802
  8. 911987Domain d2rdbb_: 2rdb B: [151922]
    Other proteins in same PDB: d2rdba_, d2rdbc_
    automated match to d1t0rb_
    complexed with fe, gol, mpo, p6g; mutant

Details for d2rdbb_

PDB Entry: 2rdb (more details), 2.1 Å

PDB Description: x-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase i100w mutant
PDB Compounds: (B:) Toluene, o-xylene monooxygenase oxygenase subunit;beta

SCOPe Domain Sequences for d2rdbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdbb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri [TaxId: 316]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmg

SCOPe Domain Coordinates for d2rdbb_:

Click to download the PDB-style file with coordinates for d2rdbb_.
(The format of our PDB-style files is described here.)

Timeline for d2rdbb_: