SCOP 1.75: Domain d2rdbb1: 2rdb B:8-329

Lineage for d2rdbb1 (2rdb B:8-329)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (1 species)

7. Species Pseudomonas stutzeri [TaxId:316] [109791] (6 PDB entries)
   Uniprot O87802

8. Domain d2rdbb1: 2rdb B:8-329 [151922]
   Other proteins in same PDB: d2rdbc1
   automatically matched to d1t0rb_
   complexed with fe, gol, mpo, p6g; mutant

Details for d2rdbb1

PDB Entry: 2rdb, 2.1 Å

PDB Description: x-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase i100w mutant

PDB Compounds: (B:) Toluene, o-xylene monooxygenase oxygenase subunit;beta

SCOP Domain Sequences for d2rdbb1:

Sequence; same for both SEQRES and ATOM records:

>d2rdbb1 a.25.1.2 (B:8-329) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri [TaxId: 316]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmg

Timeline for d2rdbb1:

• d2rdbb1 is new in SCOP 1.75
  
• d2rdbb1 is called d2rdbb_ in SCOPe 2.01
  
• d2rdbb1 appears in the current release, SCOPe 2.08, called d2rdbb_