Lineage for d2rd6a2 (2rd6 A:136-350)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000666Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 3000667Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. 3000676Species Human (Homo sapiens) [TaxId:9606] [103339] (8 PDB entries)
    Uniprot P09874 661-1010
  8. 3000677Domain d2rd6a2: 2rd6 A:136-350 [151921]
    Other proteins in same PDB: d2rd6a1
    automated match to d1gs0a2
    protein/DNA complex; complexed with 78p

Details for d2rd6a2

PDB Entry: 2rd6 (more details), 2.3 Å

PDB Description: PARP complexed with A861695
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d2rd6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rd6a2 d.166.1.2 (A:136-350) Poly(ADP-ribose) polymerase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d2rd6a2:

Click to download the PDB-style file with coordinates for d2rd6a2.
(The format of our PDB-style files is described here.)

Timeline for d2rd6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rd6a1