Lineage for d2rd6a1 (2rd6 A:1-135)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325363Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2325364Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2325365Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. 2325366Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)
  7. 2325375Species Human (Homo sapiens) [TaxId:9606] [101198] (8 PDB entries)
    Uniprot P09874 661-1010
  8. 2325377Domain d2rd6a1: 2rd6 A:1-135 [151920]
    Other proteins in same PDB: d2rd6a2
    automated match to d1gs0a1
    protein/DNA complex; complexed with 78p

Details for d2rd6a1

PDB Entry: 2rd6 (more details), 2.3 Å

PDB Description: PARP complexed with A861695
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d2rd6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rd6a1 a.41.1.1 (A:1-135) Domain of poly(ADP-ribose) polymerase {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

SCOPe Domain Coordinates for d2rd6a1:

Click to download the PDB-style file with coordinates for d2rd6a1.
(The format of our PDB-style files is described here.)

Timeline for d2rd6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rd6a2