Lineage for d2rd2a1 (2rd2 A:339-547)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061452Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2061453Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2061515Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
    automatically mapped to Pfam PF03950
  6. 2061516Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (2 species)
    duplication, consists of two barrel domains with the swapping of N-terminal strands
  7. 2061517Species Escherichia coli K-12 [TaxId:83333] [159201] (1 PDB entry)
  8. 2061518Domain d2rd2a1: 2rd2 A:339-547 [151918]
    Other proteins in same PDB: d2rd2a2
    automatically matched to d1euqa1
    protein/RNA complex; complexed with qsi, so4; mutant

Details for d2rd2a1

PDB Entry: 2rd2 (more details), 2.6 Å

PDB Description: glutaminyl-trna synthetase mutant c229r with bound analog 5'-o-[n-(l-glutaminyl)-sulfamoyl]adenosine
PDB Compounds: (A:) glutaminyl-tRNA synthetase

SCOPe Domain Sequences for d2rd2a1:

Sequence, based on SEQRES records: (download)

>d2rd2a1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli K-12 [TaxId: 83333]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt

Sequence, based on observed residues (ATOM records): (download)

>d2rd2a1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli K-12 [TaxId: 83333]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlgvihwvsaahalpvei
rlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsr
hstaekpvfnrtvglrdt

SCOPe Domain Coordinates for d2rd2a1:

Click to download the PDB-style file with coordinates for d2rd2a1.
(The format of our PDB-style files is described here.)

Timeline for d2rd2a1: