Lineage for d2rd1c1 (2rd1 C:22-73)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798178Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 798179Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (6 families) (S)
  5. 798499Family b.38.1.6: YgdI/YgdR-like [159052] (6 proteins)
    Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals
  6. 798503Protein Putative outer membrane lipoprotein STM1585 [159059] (1 species)
  7. 798504Species Salmonella typhimurium [TaxId:90371] [159060] (1 PDB entry)
    Uniprot Q7CQI7 22-73
  8. 798507Domain d2rd1c1: 2rd1 C:22-73 [151917]
    automatically matched to 2RD1 A:22-73

Details for d2rd1c1

PDB Entry: 2rd1 (more details), 2.3 Å

PDB Description: x-ray structure of the protein q7cqi7. northeast structural genomics consortium target str87a
PDB Compounds: (C:) Putative outer membrane lipoprotein

SCOP Domain Sequences for d2rd1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rd1c1 b.38.1.6 (C:22-73) Putative outer membrane lipoprotein STM1585 {Salmonella typhimurium [TaxId: 90371]}
tnyvmttkngqtivtqgkpqldketgmtsytdqegnqreinsndvaqlikad

SCOP Domain Coordinates for d2rd1c1:

Click to download the PDB-style file with coordinates for d2rd1c1.
(The format of our PDB-style files is described here.)

Timeline for d2rd1c1: