SCOPe 2.06: Domain d2rd1a1: 2rd1 A:22-73

Lineage for d2rd1a1 (2rd1 A:22-73)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins)
   Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals

6. Protein Putative outer membrane lipoprotein STM1585 [159059] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [159060] (1 PDB entry)
   Uniprot Q7CQI7 22-73

8. Domain d2rd1a1: 2rd1 A:22-73 [151915]
   Other proteins in same PDB: d2rd1a2, d2rd1b3, d2rd1c3

Details for d2rd1a1

PDB Entry: 2rd1, 2.3 Å

PDB Description: x-ray structure of the protein q7cqi7. northeast structural genomics consortium target str87a

PDB Compounds: (A:) Putative outer membrane lipoprotein

SCOPe Domain Sequences for d2rd1a1:

Sequence; same for both SEQRES and ATOM records:

>d2rd1a1 b.38.1.6 (A:22-73) Putative outer membrane lipoprotein STM1585 {Salmonella typhimurium [TaxId: 90371]}
tnyvmttkngqtivtqgkpqldketgmtsytdqegnqreinsndvaqlikad

Timeline for d2rd1a1:

• d2rd1a1 first appeared in SCOP 1.75
  
• d2rd1a1 appears in SCOPe 2.05
  
• d2rd1a1 appears in SCOPe 2.07
  
• d2rd1a1 appears in the current release, SCOPe 2.08