Lineage for d2rcxa1 (2rcx A:4-361)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883341Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 883342Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 883343Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)
  6. 883349Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 883369Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (46 PDB entries)
  8. 883424Domain d2rcxa1: 2rcx A:4-361 [151913]
    automatically matched to d1c3ba_
    complexed with po4, sm4

Details for d2rcxa1

PDB Entry: 2rcx (more details), 2 Å

PDB Description: ampc beta-lactamase in complex with (1r)-1-(2-thiophen-2-yl- acetylamino)-1-(3-(2-carboxyvinyl)-phenyl) methylboronic acid
PDB Compounds: (A:) Beta-lactamase

SCOP Domain Sequences for d2rcxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcxa1 e.3.1.1 (A:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOP Domain Coordinates for d2rcxa1:

Click to download the PDB-style file with coordinates for d2rcxa1.
(The format of our PDB-style files is described here.)

Timeline for d2rcxa1: