![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins) automatically mapped to Pfam PF00644 |
![]() | Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103339] (8 PDB entries) Uniprot P09874 661-1010 |
![]() | Domain d2rcwa2: 2rcw A:138-350 [151912] Other proteins in same PDB: d2rcwa1 automated match to d1uk1a2 protein/DNA complex; complexed with aai |
PDB Entry: 2rcw (more details), 2.8 Å
SCOPe Domain Sequences for d2rcwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcwa2 d.166.1.2 (A:138-350) Poly(ADP-ribose) polymerase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} tdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhnrr llwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpigl illgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgissg vndtsllyneyivydiaqvnlkyllklkfnfkt
Timeline for d2rcwa2: