Lineage for d2rcwa2 (2rcw A:138-350)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000666Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 3000667Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. 3000676Species Human (Homo sapiens) [TaxId:9606] [103339] (8 PDB entries)
    Uniprot P09874 661-1010
  8. 3000680Domain d2rcwa2: 2rcw A:138-350 [151912]
    Other proteins in same PDB: d2rcwa1
    automated match to d1uk1a2
    protein/DNA complex; complexed with aai

Details for d2rcwa2

PDB Entry: 2rcw (more details), 2.8 Å

PDB Description: PARP complexed with A620223
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d2rcwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcwa2 d.166.1.2 (A:138-350) Poly(ADP-ribose) polymerase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhnrr
llwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpigl
illgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgissg
vndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d2rcwa2:

Click to download the PDB-style file with coordinates for d2rcwa2.
(The format of our PDB-style files is described here.)

Timeline for d2rcwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rcwa1