Lineage for d1dwsa_ (1dws A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) 
Species Horse (Equus caballus) [TaxId:9796] [46474] (13 PDB entries) 
Domain d1dwsa_: 1dws A: [15191]
Details for d1dwsa_
PDB Entry: 1dws (more details), 1.45 Å
PDB Description: photolyzed carbonmonoxy myoglobin (horse heart)
SCOP Domain Sequences for d1dwsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dwsa_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq
SCOP Domain Coordinates for d1dwsa_:
Click to download the PDB-style file with coordinates for d1dwsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dwsa_:
- d1dwsa_ appears in SCOP 1.57
- d1dwsa_ appears in the current release, SCOPe 2.08
View in 3D