SCOPe 2.08: Domain d1dwsa_: 1dws A:

Lineage for d1dwsa_ (1dws A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (11 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries)

8. Domain d1dwsa_: 1dws A: [15191]
   complexed with cmo, hem, so4

Details for d1dwsa_

PDB Entry: 1dws, 1.45 Å

PDB Description: photolyzed carbonmonoxy myoglobin (horse heart)

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1dwsa_:

Sequence; same for both SEQRES and ATOM records:

>d1dwsa_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

Timeline for d1dwsa_:

• d1dwsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1dwsa_ appears in SCOPe 2.07