SCOPe 2.04: Domain d2rcjr1: 2rcj R:11-116

Lineage for d2rcjr1 (2rcj R:11-116)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (29 PDB entries)

8. Domain d2rcjr1: 2rcj R:11-116 [151908]
   Other proteins in same PDB: d2rcja2, d2rcjb2, d2rcje2, d2rcjf2, d2rcji2, d2rcjj2, d2rcjm2, d2rcjn2, d2rcjq2, d2rcjr2, d2rcju1
   automatically matched to d1ymme1

Details for d2rcjr1

PDB Entry: 2rcj

PDB Description: solution structure of human immunoglobulin m

PDB Compounds: (R:) Immunogloblin M heavy chain

SCOPe Domain Sequences for d2rcjr1:

Sequence; same for both SEQRES and ATOM records:

>d2rcjr1 b.1.1.1 (R:11-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
vvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhyadsvkgrfti
srndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtv

Timeline for d2rcjr1:

• d2rcjr1 first appeared in SCOP 1.75
  
• d2rcjr1 appears in SCOPe 2.03
  
• d2rcjr1 appears in SCOPe 2.05
  
• d2rcjr1 appears in the current release, SCOPe 2.08