Lineage for d2rcjj1 (2rcj J:11-116)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512530Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1512558Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (29 PDB entries)
  8. 1512605Domain d2rcjj1: 2rcj J:11-116 [151900]
    Other proteins in same PDB: d2rcja2, d2rcjb2, d2rcje2, d2rcjf2, d2rcji2, d2rcjj2, d2rcjm2, d2rcjn2, d2rcjq2, d2rcjr2, d2rcju1
    automatically matched to d1ymme1

Details for d2rcjj1

PDB Entry: 2rcj (more details)

PDB Description: solution structure of human immunoglobulin m
PDB Compounds: (J:) Immunogloblin M heavy chain

SCOPe Domain Sequences for d2rcjj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcjj1 b.1.1.1 (J:11-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
vvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhyadsvkgrfti
srndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtv

SCOPe Domain Coordinates for d2rcjj1:

Click to download the PDB-style file with coordinates for d2rcjj1.
(The format of our PDB-style files is described here.)

Timeline for d2rcjj1: