Lineage for d2rcja1 (2rcj A:11-116)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783727Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 783750Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
  8. 783793Domain d2rcja1: 2rcj A:11-116 [151890]
    Other proteins in same PDB: d2rcja2, d2rcjb2, d2rcje2, d2rcjf2, d2rcji2, d2rcjj2, d2rcjm2, d2rcjn2, d2rcjq2, d2rcjr2, d2rcju1
    automatically matched to d1ymme1

Details for d2rcja1

PDB Entry: 2rcj (more details)

PDB Description: solution structure of human immunoglobulin m
PDB Compounds: (A:) Immunogloblin M heavy chain

SCOP Domain Sequences for d2rcja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcja1 b.1.1.1 (A:11-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
vvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhyadsvkgrfti
srndskntlflqmdslrpedtgvyfcardggssapdywgqgtpvtv

SCOP Domain Coordinates for d2rcja1:

Click to download the PDB-style file with coordinates for d2rcja1.
(The format of our PDB-style files is described here.)

Timeline for d2rcja1: