SCOPe 2.01: Domain d1pmbb_: 1pmb B:

Lineage for d1pmbb_ (1pmb B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)

8. Domain d1pmbb_: 1pmb B: [15189]
   complexed with hem

Details for d1pmbb_

PDB Entry: 1pmb, 2.5 Å

PDB Description: the determination of the crystal structure of recombinant pig myoglobin by molecular replacement and its refinement

PDB Compounds: (B:) Myoglobin

SCOPe Domain Sequences for d1pmbb_:

Sequence; same for both SEQRES and ATOM records:

>d1pmbb_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

Timeline for d1pmbb_:

• d1pmbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1pmbb_ appears in SCOP 1.75
  
• d1pmbb_ appears in SCOPe 2.02
  
• d1pmbb_ appears in the current release, SCOPe 2.08