Lineage for d2rcfe_ (2rcf E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2400823Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) (S)
    homohexameric unit
  5. 2400824Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins)
    Pfam PF03319
  6. 2400879Protein Carboxysome shell protein [159137] (1 species)
    Unidentified carboxysome polypeptide
  7. 2400880Species Thiobacillus neapolitanus [TaxId:927] [159138] (1 PDB entry)
    Uniprot O85043 1-82
  8. 2400885Domain d2rcfe_: 2rcf E: [151889]
    automated match to d2rcfa1
    complexed with cl, gol

Details for d2rcfe_

PDB Entry: 2rcf (more details), 2.15 Å

PDB Description: carboxysome shell protein, orfa from h. neapolitanus
PDB Compounds: (E:) Unidentified carboxysome polypeptide

SCOPe Domain Sequences for d2rcfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcfe_ b.40.15.1 (E:) Carboxysome shell protein {Thiobacillus neapolitanus [TaxId: 927]}
mkimqvektlvstnriadmghkpllvvwekpgaprqvavdaigcipgdwvlcvgssaare
aagsksypsdltiigiidqw

SCOPe Domain Coordinates for d2rcfe_:

Click to download the PDB-style file with coordinates for d2rcfe_.
(The format of our PDB-style files is described here.)

Timeline for d2rcfe_: