SCOP 1.75: Domain d2rcfe1: 2rcf E:1-80

Lineage for d2rcfe1 (2rcf E:1-80)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.15: EutN/CcmL-like [159133] (1 family)
   homohexameric unit

5. Family b.40.15.1: EutN/CcmL-like [159134] (3 proteins)
   Pfam PF03319

6. Protein Carboxysome shell protein [159137] (1 species)
   Unidentified carboxysome polypeptide

7. Species Thiobacillus neapolitanus [TaxId:927] [159138] (1 PDB entry)
   Uniprot O85043 1-82

8. Domain d2rcfe1: 2rcf E:1-80 [151889]
   automatically matched to 2RCF A:1-82
   complexed with cl, gol

Details for d2rcfe1

PDB Entry: 2rcf, 2.15 Å

PDB Description: carboxysome shell protein, orfa from h. neapolitanus

PDB Compounds: (E:) Unidentified carboxysome polypeptide

SCOP Domain Sequences for d2rcfe1:

Sequence; same for both SEQRES and ATOM records:

>d2rcfe1 b.40.15.1 (E:1-80) Carboxysome shell protein {Thiobacillus neapolitanus [TaxId: 927]}
mkimqvektlvstnriadmghkpllvvwekpgaprqvavdaigcipgdwvlcvgssaare
aagsksypsdltiigiidqw

Timeline for d2rcfe1:

• d2rcfe1 is new in SCOP 1.75
  
• d2rcfe1 is called d2rcfe_ in SCOPe 2.01
  
• d2rcfe1 appears in the current release, SCOPe 2.08, called d2rcfe_