Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.15: EutN/CcmL-like [159133] (1 family) homohexameric unit |
Family b.40.15.1: EutN/CcmL-like [159134] (3 proteins) Pfam PF03319 |
Protein Carboxysome shell protein [159137] (1 species) Unidentified carboxysome polypeptide |
Species Thiobacillus neapolitanus [TaxId:927] [159138] (1 PDB entry) Uniprot O85043 1-82 |
Domain d2rcfc1: 2rcf C:1-81 [151887] automatically matched to 2RCF A:1-82 complexed with cl, gol |
PDB Entry: 2rcf (more details), 2.15 Å
SCOP Domain Sequences for d2rcfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcfc1 b.40.15.1 (C:1-81) Carboxysome shell protein {Thiobacillus neapolitanus [TaxId: 927]} mkimqvektlvstnriadmghkpllvvwekpgaprqvavdaigcipgdwvlcvgssaare aagsksypsdltiigiidqwn
Timeline for d2rcfc1:
View in 3D Domains from other chains: (mouse over for more information) d2rcfa1, d2rcfb1, d2rcfd1, d2rcfe1 |