Lineage for d2rcfb1 (2rcf B:1-81)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 800617Superfamily b.40.15: EutN/CcmL-like [159133] (1 family) (S)
    homohexameric unit
  5. 800618Family b.40.15.1: EutN/CcmL-like [159134] (3 proteins)
    Pfam PF03319
  6. 800631Protein Carboxysome shell protein [159137] (1 species)
    Unidentified carboxysome polypeptide
  7. 800632Species Thiobacillus neapolitanus [TaxId:927] [159138] (1 PDB entry)
    Uniprot O85043 1-82
  8. 800634Domain d2rcfb1: 2rcf B:1-81 [151886]
    automatically matched to 2RCF A:1-82
    complexed with cl, gol

Details for d2rcfb1

PDB Entry: 2rcf (more details), 2.15 Å

PDB Description: carboxysome shell protein, orfa from h. neapolitanus
PDB Compounds: (B:) Unidentified carboxysome polypeptide

SCOP Domain Sequences for d2rcfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcfb1 b.40.15.1 (B:1-81) Carboxysome shell protein {Thiobacillus neapolitanus [TaxId: 927]}
mkimqvektlvstnriadmghkpllvvwekpgaprqvavdaigcipgdwvlcvgssaare
aagsksypsdltiigiidqwn

SCOP Domain Coordinates for d2rcfb1:

Click to download the PDB-style file with coordinates for d2rcfb1.
(The format of our PDB-style files is described here.)

Timeline for d2rcfb1: