Lineage for d2rceg1 (2rce G:43-252)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318224Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1318362Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)
  7. 1318363Species Escherichia coli [TaxId:562] [110237] (9 PDB entries)
    Uniprot P31137 37-354 ! Uniprot P31137
  8. 1318373Domain d2rceg1: 2rce G:43-252 [151882]
    automatically matched to d1sota2

Details for d2rceg1

PDB Entry: 2rce (more details), 2.35 Å

PDB Description: dfp modified degs delta pdz
PDB Compounds: (G:) Protease degS

SCOPe Domain Sequences for d2rceg1:

Sequence, based on SEQRES records: (download)

>d2rceg1 b.47.1.1 (G:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad
qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy
nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk
sndgetpegigfaipfqlatkimdklirdg

Sequence, based on observed residues (ATOM records): (download)

>d2rceg1 b.47.1.1 (G:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
tpasynlavrraapavvnvynleirtlgsgvimdqrgyiitnkhvindadqiivalqdgr
vfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpynlgqtitqgi
isatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdkdgetpegigf
aipfqlatkimdklirdg

SCOPe Domain Coordinates for d2rceg1:

Click to download the PDB-style file with coordinates for d2rceg1.
(The format of our PDB-style files is described here.)

Timeline for d2rceg1: