Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (15 proteins) |
Protein Stress sensor protease DegS, catalytic domain [110236] (1 species) |
Species Escherichia coli [TaxId:562] [110237] (9 PDB entries) Uniprot P31137 37-354 Uniprot P31137 Uniprot P31137 37-354 ! Uniprot P31137 |
Domain d2rcef1: 2rce F:43-252 [151881] automatically matched to d1sota2 |
PDB Entry: 2rce (more details), 2.35 Å
SCOP Domain Sequences for d2rcef1:
Sequence, based on SEQRES records: (download)
>d2rcef1 b.47.1.1 (F:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdk sndgetpegigfaipfqlatkimdklirdg
>d2rcef1 b.47.1.1 (F:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} tpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvindad qiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpy nlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfde tpegigfaipfqlatkimdklirdg
Timeline for d2rcef1: