Lineage for d1pmba_ (1pmb A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2301126Protein Myoglobin [46469] (10 species)
  7. 2301229Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 2301259Domain d1pmba_: 1pmb A: [15188]
    complexed with hem

Details for d1pmba_

PDB Entry: 1pmb (more details), 2.5 Å

PDB Description: the determination of the crystal structure of recombinant pig myoglobin by molecular replacement and its refinement
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1pmba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmba_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgntvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOPe Domain Coordinates for d1pmba_:

Click to download the PDB-style file with coordinates for d1pmba_.
(The format of our PDB-style files is described here.)

Timeline for d1pmba_: