Lineage for d2rc4a1 (2rc4 A:507-779)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870001Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870002Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) (S)
  5. 870003Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins)
  6. 870119Protein Histone acetyltransferase MYST3 [143702] (1 species)
    ESA1 orthologue
  7. 870120Species Human (Homo sapiens) [TaxId:9606] [143703] (2 PDB entries)
    Uniprot Q92794 507-776
    solution structure of the zinc-binding motif have been determined in isolation (PDB 1m36, (103600))
    solution structure of the zinc-binding motif have been determined in isolation (PDB 1m36, (103600))
  8. 870122Domain d2rc4a1: 2rc4 A:507-779 [151871]
    complexed with aco, zn

Details for d2rc4a1

PDB Entry: 2rc4 (more details), 3 Å

PDB Description: crystal structure of the hat domain of the human moz protein
PDB Compounds: (A:) Histone acetyltransferase MYST3

SCOP Domain Sequences for d2rc4a1:

Sequence, based on SEQRES records: (download)

>d2rc4a1 d.108.1.1 (A:507-779) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]}
rcpsviefgkyeihtwysspypqeysrlpklylcefclkymksrtilqqhmkkcgwfhpp
aneiyrknnisvfevdgnvstiycqnlcllaklfldhktlyydvepflfyvltqndvkgc
hlvgyfskekhcqqkynvscimilpqyqrkgygrflidfsyllskregqagspekplsdl
grlsymaywksvileclyhqndkqisikklskltgicpqditstlhhlrmldfrsdqfvr
rrrekliqdhmaklqlnlrpvdvdpeclrwtpv

Sequence, based on observed residues (ATOM records): (download)

>d2rc4a1 d.108.1.1 (A:507-779) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]}
rcpsviefgkyeihtwysspypqeysrlpklylcefclkymksrtilqqhmkkcgwfhpp
aneiyrknnisvfevdgnvstiycqnlcllaklfldhktlyydvepflfyvltqndvkgc
hlvgyfskekhcqqkynvscimilpqyqrkgygrflidfsyllskregqagspekplsdl
grlsymaywksvileclyhqndkqisikklskltgicpqditstlhhlrmldrrekliqd
hmaklqlnlrpvdvdpeclrwtpv

SCOP Domain Coordinates for d2rc4a1:

Click to download the PDB-style file with coordinates for d2rc4a1.
(The format of our PDB-style files is described here.)

Timeline for d2rc4a1: