Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein Uncharacterized protein NE2398 [160172] (1 species) |
Species Nitrosomonas europaea [TaxId:915] [160173] (1 PDB entry) Uniprot Q82SE2 1-127 |
Domain d2rc3d_: 2rc3 D: [151870] Other proteins in same PDB: d2rc3b3, d2rc3c3 automated match to d2rc3a1 complexed with br, nad |
PDB Entry: 2rc3 (more details), 1.6 Å
SCOPe Domain Sequences for d2rc3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rc3d_ d.37.1.1 (D:) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} mktvkhllqekghtvvaigpddsvfnamqkmaadnigallvmkdeklvgilterdfsrks ylldkpvkdtqvkeimtrqvayvdlnntnedcmalitemrvrhlpvlddgkvigllsigd lvkdais
Timeline for d2rc3d_: