![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Myoglobin [46469] (11 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries) |
![]() | Domain d1mnha_: 1mnh A: [15187] complexed with hem |
PDB Entry: 1mnh (more details), 2.3 Å
SCOPe Domain Sequences for d1mnha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mnha_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]} glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased lkkvgnrvltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp gdfgadaqgamskalelfrndmaakykelgfqg
Timeline for d1mnha_: