Lineage for d2rc3c2 (2rc3 C:23-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943255Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2943377Protein Uncharacterized protein NE2398 [160172] (1 species)
  7. 2943378Species Nitrosomonas europaea [TaxId:915] [160173] (1 PDB entry)
    Uniprot Q82SE2 1-127
  8. 2943381Domain d2rc3c2: 2rc3 C:23-149 [151869]
    Other proteins in same PDB: d2rc3b3, d2rc3c3
    automated match to d2rc3a1
    complexed with br, nad

Details for d2rc3c2

PDB Entry: 2rc3 (more details), 1.6 Å

PDB Description: crystal structure of cbs domain, ne2398
PDB Compounds: (C:) CBS domain

SCOPe Domain Sequences for d2rc3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rc3c2 d.37.1.1 (C:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]}
mktvkhllqekghtvvaigpddsvfnamqkmaadnigallvmkdeklvgilterdfsrks
ylldkpvkdtqvkeimtrqvayvdlnntnedcmalitemrvrhlpvlddgkvigllsigd
lvkdais

SCOPe Domain Coordinates for d2rc3c2:

Click to download the PDB-style file with coordinates for d2rc3c2.
(The format of our PDB-style files is described here.)

Timeline for d2rc3c2: