Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein Uncharacterized protein NE2398 [160172] (1 species) |
Species Nitrosomonas europaea [TaxId:915] [160173] (1 PDB entry) Uniprot Q82SE2 1-127 |
Domain d2rc3c2: 2rc3 C:23-149 [151869] Other proteins in same PDB: d2rc3b3, d2rc3c3 automated match to d2rc3a1 complexed with br, nad |
PDB Entry: 2rc3 (more details), 1.6 Å
SCOPe Domain Sequences for d2rc3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rc3c2 d.37.1.1 (C:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} mktvkhllqekghtvvaigpddsvfnamqkmaadnigallvmkdeklvgilterdfsrks ylldkpvkdtqvkeimtrqvayvdlnntnedcmalitemrvrhlpvlddgkvigllsigd lvkdais
Timeline for d2rc3c2:
View in 3D Domains from other chains: (mouse over for more information) d2rc3a1, d2rc3b2, d2rc3b3, d2rc3d_ |