SCOPe 2.08: Domain d2rc3c2: 2rc3 C:23-149

Lineage for d2rc3c2 (2rc3 C:23-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Uncharacterized protein NE2398 [160172] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [160173] (1 PDB entry)
   Uniprot Q82SE2 1-127

8. Domain d2rc3c2: 2rc3 C:23-149 [151869]
   Other proteins in same PDB: d2rc3b3, d2rc3c3
   automated match to d2rc3a1
   complexed with br, nad

Details for d2rc3c2

PDB Entry: 2rc3, 1.6 Å

PDB Description: crystal structure of cbs domain, ne2398

PDB Compounds: (C:) CBS domain

SCOPe Domain Sequences for d2rc3c2:

Sequence; same for both SEQRES and ATOM records:

>d2rc3c2 d.37.1.1 (C:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]}
mktvkhllqekghtvvaigpddsvfnamqkmaadnigallvmkdeklvgilterdfsrks
ylldkpvkdtqvkeimtrqvayvdlnntnedcmalitemrvrhlpvlddgkvigllsigd
lvkdais

Timeline for d2rc3c2:

• d2rc3c2 first appeared in SCOP 1.75, called d2rc3c1
  
• d2rc3c2 appears in SCOPe 2.07