Lineage for d2rbxx1 (2rbx X:4-294)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773241Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 773242Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 773243Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 773259Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 773260Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (123 PDB entries)
    Uniprot P00431
  8. 773277Domain d2rbxx1: 2rbx X:4-294 [151861]
    automatically matched to d1ac4a_
    complexed with 3ay, hem, po4; mutant

Details for d2rbxx1

PDB Entry: 2rbx (more details), 1.5 Å

PDB Description: cytochrome c peroxidase w191g in complex with pyrimidine-2,4,6- triamine.
PDB Compounds: (X:) cytochrome c peroxidase

SCOP Domain Sequences for d2rbxx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rbxx1 a.93.1.1 (X:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d2rbxx1:

Click to download the PDB-style file with coordinates for d2rbxx1.
(The format of our PDB-style files is described here.)

Timeline for d2rbxx1: