Lineage for d2rbxx_ (2rbx X:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2719985Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2719986Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries)
    Uniprot P00431
  8. 2720056Domain d2rbxx_: 2rbx X: [151861]
    automated match to d1ac4a_
    complexed with 3ay, hem, po4

Details for d2rbxx_

PDB Entry: 2rbx (more details), 1.5 Å

PDB Description: cytochrome c peroxidase w191g in complex with pyrimidine-2,4,6- triamine.
PDB Compounds: (X:) cytochrome c peroxidase

SCOPe Domain Sequences for d2rbxx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rbxx_ a.93.1.1 (X:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
knsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
kylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2rbxx_:

Click to download the PDB-style file with coordinates for d2rbxx_.
(The format of our PDB-style files is described here.)

Timeline for d2rbxx_: