Lineage for d1ycab_ (1yca B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2687978Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 2688011Domain d1ycab_: 1yca B: [15186]
    complexed with cmo, hem; mutant

Details for d1ycab_

PDB Entry: 1yca (more details), 2.9 Å

PDB Description: distal pocket polarity in ligand binding to myoglobin: deoxy and carbonmonoxy forms of a threonine68 (e11) mutant investigated by x-ray crystallography and infrared spectroscopy
PDB Compounds: (B:) Myoglobin

SCOPe Domain Sequences for d1ycab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycab_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOPe Domain Coordinates for d1ycab_:

Click to download the PDB-style file with coordinates for d1ycab_.
(The format of our PDB-style files is described here.)

Timeline for d1ycab_: