![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (5 proteins) |
![]() | Protein Cytochrome c peroxidase, CCP [48119] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries) Uniprot P00431 |
![]() | Domain d2rbtx_: 2rbt X: [151857] automated match to d1ac4a_ complexed with 271, hem, mpd, po4 |
PDB Entry: 2rbt (more details), 1.24 Å
SCOPe Domain Sequences for d2rbtx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rbtx_ a.93.1.1 (X:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl knsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp kylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl
Timeline for d2rbtx_: