Lineage for d2rbka_ (2rbk A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2167325Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2167389Protein Sugar-phosphate phosphatase BT4131 [142157] (1 species)
  7. 2167390Species Bacteroides thetaiotaomicron [TaxId:818] [142158] (5 PDB entries)
    Uniprot Q8A090 2-261
  8. 2167391Domain d2rbka_: 2rbk A: [151850]
    automated match to d1ymqa1
    complexed with mg, vn4

Details for d2rbka_

PDB Entry: 2rbk (more details), 1 Å

PDB Description: X-ray Crystallographic Structures Show Conservation of a Trigonal-Bipyramidal Intermediate in a Phosphoryl-transfer Superfamily.
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d2rbka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rbka_ c.108.1.10 (A:) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]}
mtkalffdidgtlvsfethripsstiealeaahakglkifiatgrpkaiinnlselqdrn
lidgyitmngaycfvgeeviyksaipqeevkamaafcekkgvpcifveehnisvcqpnem
vkkifydflhvnviptvsfeeasnkeviqmtpfiteeeekevlpsiptceigrwypafad
vtakgdtkqkgideiirhfgikleetmsfgdggndismlrhaaigvamgqakedvkaaad
yvtapidedgiskamkhfgii

SCOPe Domain Coordinates for d2rbka_:

Click to download the PDB-style file with coordinates for d2rbka_.
(The format of our PDB-style files is described here.)

Timeline for d2rbka_: