Lineage for d1ycaa_ (1yca A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717376Protein Myoglobin [46469] (9 species)
  7. 1717472Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 1717504Domain d1ycaa_: 1yca A: [15185]
    complexed with cmo, hem; mutant

Details for d1ycaa_

PDB Entry: 1yca (more details), 2.9 Å

PDB Description: distal pocket polarity in ligand binding to myoglobin: deoxy and carbonmonoxy forms of a threonine68 (e11) mutant investigated by x-ray crystallography and infrared spectroscopy
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1ycaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycaa_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOPe Domain Coordinates for d1ycaa_:

Click to download the PDB-style file with coordinates for d1ycaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ycaa_: