| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Myoglobin [46469] (11 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries) |
| Domain d1ycaa_: 1yca A: [15185] complexed with cmo, hem; mutant |
PDB Entry: 1yca (more details), 2.9 Å
SCOPe Domain Sequences for d1ycaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycaa_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg
Timeline for d1ycaa_: