Lineage for d2rbec_ (2rbe C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1151047Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1151074Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 1151090Species Human (Homo sapiens) [TaxId:9606] [117424] (20 PDB entries)
    Uniprot P28845
  8. 1151105Domain d2rbec_: 2rbe C: [151848]
    automated match to d1xu9a_
    complexed with ndp, zmg

Details for d2rbec_

PDB Entry: 2rbe (more details), 1.9 Å

PDB Description: the discovery of 2-anilinothiazolones as 11beta-hsd1 inhibitors
PDB Compounds: (C:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d2rbec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rbec_ c.2.1.2 (C:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
llirnpsrkilefly

SCOPe Domain Coordinates for d2rbec_:

Click to download the PDB-style file with coordinates for d2rbec_.
(The format of our PDB-style files is described here.)

Timeline for d2rbec_: