Lineage for d2rb6b_ (2rb6 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948630Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 948631Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 949024Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins)
    Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals
  6. 949045Protein Uncharacterized protein SO0963 [159053] (1 species)
  7. 949046Species Shewanella oneidensis [TaxId:70863] [159054] (1 PDB entry)
    Uniprot Q8EI81 25-76
  8. 949048Domain d2rb6b_: 2rb6 B: [151845]
    automated match to d2rb6a1

Details for d2rb6b_

PDB Entry: 2rb6 (more details), 2.5 Å

PDB Description: x-ray structure of the protein q8ei81. northeast structural genomics consortium target sor78a
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d2rb6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rb6b_ b.38.1.6 (B:) Uncharacterized protein SO0963 {Shewanella oneidensis [TaxId: 70863]}
ssqyimstkdgkmitsdskpkldkttgmylyydedgrevmikqedvtqiierlehh

SCOPe Domain Coordinates for d2rb6b_:

Click to download the PDB-style file with coordinates for d2rb6b_.
(The format of our PDB-style files is described here.)

Timeline for d2rb6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2rb6a1