![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins) Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals |
![]() | Protein Uncharacterized protein SO0963 [159053] (1 species) |
![]() | Species Shewanella oneidensis [TaxId:70863] [159054] (1 PDB entry) Uniprot Q8EI81 25-76 |
![]() | Domain d2rb6a1: 2rb6 A:25-76 [151844] Other proteins in same PDB: d2rb6a2, d2rb6b3 |
PDB Entry: 2rb6 (more details), 2.5 Å
SCOPe Domain Sequences for d2rb6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rb6a1 b.38.1.6 (A:25-76) Uncharacterized protein SO0963 {Shewanella oneidensis [TaxId: 70863]} ssqyimstkdgkmitsdskpkldkttgmylyydedgrevmikqedvtqiier
Timeline for d2rb6a1: