Lineage for d2rb6a1 (2rb6 A:25-76)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798178Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 798179Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (6 families) (S)
  5. 798499Family b.38.1.6: YgdI/YgdR-like [159052] (6 proteins)
    Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals
  6. 798520Protein Uncharacterized protein SO0963 [159053] (1 species)
  7. 798521Species Shewanella oneidensis [TaxId:70863] [159054] (1 PDB entry)
    Uniprot Q8EI81 25-76
  8. 798522Domain d2rb6a1: 2rb6 A:25-76 [151844]

Details for d2rb6a1

PDB Entry: 2rb6 (more details), 2.5 Å

PDB Description: x-ray structure of the protein q8ei81. northeast structural genomics consortium target sor78a
PDB Compounds: (A:) Uncharacterized protein

SCOP Domain Sequences for d2rb6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rb6a1 b.38.1.6 (A:25-76) Uncharacterized protein SO0963 {Shewanella oneidensis [TaxId: 70863]}
ssqyimstkdgkmitsdskpkldkttgmylyydedgrevmikqedvtqiier

SCOP Domain Coordinates for d2rb6a1:

Click to download the PDB-style file with coordinates for d2rb6a1.
(The format of our PDB-style files is described here.)

Timeline for d2rb6a1: