SCOPe 2.08: Domain d2rb5a_: 2rb5 A:

Lineage for d2rb5a_ (2rb5 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Sugar-phosphate phosphatase BT4131 [142157] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [142158] (5 PDB entries)
   Uniprot Q8A090 2-261

8. Domain d2rb5a_: 2rb5 A: [151843]
   automated match to d1ymqa1
   complexed with mg, wo6

Details for d2rb5a_

PDB Entry: 2rb5, 1.03 Å

PDB Description: X-ray Crystallographic Structures Show Conservation of a Trigonal-Bipyramidal Intermediate in a Phosphoryl-transfer Superfamily.

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d2rb5a_:

Sequence; same for both SEQRES and ATOM records:

>d2rb5a_ c.108.1.10 (A:) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]}
mtkalffdidgtlvsfethripsstiealeaahakglkifiatgrpkaiinnlselqdrn
lidgyitmngaycfvgeeviyksaipqeevkamaafcekkgvpcifveehnisvcqpnem
vkkifydflhvnviptvsfeeasnkeviqmtpfiteeeekevlpsiptceigrwypafad
vtakgdtkqkgideiirhfgikleetmsfgdggndismlrhaaigvamgqakedvkaaad
yvtapidedgiskamkhfgii

Timeline for d2rb5a_:

• d2rb5a_ first appeared in SCOP 1.75, called d2rb5a1
  
• d2rb5a_ appears in SCOPe 2.07