Lineage for d2rb0x_ (2rb0 X:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1888126Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 1888132Protein Phage T4 lysozyme [53982] (1 species)
  7. 1888133Species Bacteriophage T4 [TaxId:10665] [53983] (546 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 1888473Domain d2rb0x_: 2rb0 X: [151840]
    automated match to d181la_
    complexed with 260, po4

Details for d2rb0x_

PDB Entry: 2rb0 (more details), 1.84 Å

PDB Description: 2,6-difluorobenzylbromide complex with t4 lysozyme l99a
PDB Compounds: (X:) lysozyme

SCOPe Domain Sequences for d2rb0x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rb0x_ d.2.1.3 (X:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d2rb0x_:

Click to download the PDB-style file with coordinates for d2rb0x_.
(The format of our PDB-style files is described here.)

Timeline for d2rb0x_: