Class a: All alpha proteins [46456] (226 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries) |
Domain d1ycbb_: 1ycb B: [15184] complexed with hem; mutant |
PDB Entry: 1ycb (more details), 2.1 Å
SCOP Domain Sequences for d1ycbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycbb_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa)} glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp gdfgadaqgamskalelfrndmaakykelgfqg
Timeline for d1ycbb_: