| Class g: Small proteins [56992] (94 folds) |
| Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
| Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
| Protein Anti-apoptotic protein survivin [57930] (2 species) contains a long alpha-helix after the common fold |
| Species Human (Homo sapiens) [TaxId:9606] [57931] (9 PDB entries) |
| Domain d2raxe1: 2rax E:7-117 [151836] automatically matched to d1xoxa1 complexed with zn |
PDB Entry: 2rax (more details), 3.3 Å
SCOPe Domain Sequences for d2raxe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2raxe1 g.52.1.1 (E:7-117) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]}
ppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkeleg
wepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket
Timeline for d2raxe1: