Lineage for d2raxe1 (2rax E:7-117)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894130Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 894131Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 894132Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins)
  6. 894139Protein Anti-apoptotic protein survivin [57930] (2 species)
    contains a long alpha-helix after the common fold
  7. 894140Species Human (Homo sapiens) [TaxId:9606] [57931] (5 PDB entries)
  8. 894148Domain d2raxe1: 2rax E:7-117 [151836]
    automatically matched to d1xoxa1
    complexed with zn

Details for d2raxe1

PDB Entry: 2rax (more details), 3.3 Å

PDB Description: Crystal structure of Borealin (20-78) bound to Survivin (1-120)
PDB Compounds: (E:) Baculoviral IAP repeat-containing protein 5

SCOP Domain Sequences for d2raxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2raxe1 g.52.1.1 (E:7-117) Anti-apoptotic protein survivin {Human (Homo sapiens) [TaxId: 9606]}
ppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkeleg
wepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaket

SCOP Domain Coordinates for d2raxe1:

Click to download the PDB-style file with coordinates for d2raxe1.
(The format of our PDB-style files is described here.)

Timeline for d2raxe1: