SCOP 1.57: Domain d1ycba_: 1ycb A:

Lineage for d1ycba_ (1ycb A:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (17 proteins)

6. Protein Myoglobin [46469] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)

8. Domain d1ycba_: 1ycb A: [15183]

Details for d1ycba_

PDB Entry: 1ycb, 2.1 Å

PDB Description: distal pocket polarity in ligand binding to myoglobin: deoxy and carbonmonoxy forms of a threonine68 (e11) mutant investigated by x-ray crystallography and infrared spectroscopy

SCOP Domain Sequences for d1ycba_:

Sequence; same for both SEQRES and ATOM records:

>d1ycba_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

Timeline for d1ycba_:

• d1ycba_ first appeared (with stable ids) in SCOP 1.55
  
• d1ycba_ appears in SCOP 1.59
  
• d1ycba_ appears in the current release, SCOPe 2.08