Lineage for d1ycba_ (1ycb A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2301126Protein Myoglobin [46469] (10 species)
  7. 2301229Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 2301256Domain d1ycba_: 1ycb A: [15183]
    complexed with hem; mutant

Details for d1ycba_

PDB Entry: 1ycb (more details), 2.1 Å

PDB Description: distal pocket polarity in ligand binding to myoglobin: deoxy and carbonmonoxy forms of a threonine68 (e11) mutant investigated by x-ray crystallography and infrared spectroscopy
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1ycba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycba_ a.1.1.2 (A:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgfqg

SCOPe Domain Coordinates for d1ycba_:

Click to download the PDB-style file with coordinates for d1ycba_.
(The format of our PDB-style files is described here.)

Timeline for d1ycba_: