![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.61: MTH889-like [160363] (2 families) ![]() assembles into hexameric ring-like structures with the formation of a singe beta-barrel sheet of 24 strands |
![]() | Family d.58.61.1: MTH889-like [160364] (2 proteins) Pfam PF02680; DUF211, COG1888 |
![]() | Protein Uncharacterized protein MTH889 [160365] (1 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [160366] (1 PDB entry) Uniprot O26975 3-95 |
![]() | Domain d2raqc_: 2raq C: [151829] automated match to d2raqa1 complexed with ca |
PDB Entry: 2raq (more details), 3.11 Å
SCOPe Domain Sequences for d2raqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2raqc_ d.58.61.1 (C:) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} akglirivldilkphepiipeyakylselrgvegvnitlmeidketenikvtiqgndldf deitraiesyggsihsvdevvagrtmveevttp
Timeline for d2raqc_: