SCOPe 2.05: Domain d2radb_: 2rad B:

Lineage for d2radb_ (2rad B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.150: EreA/ChaN-like [159500] (1 superfamily)
   Core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order:51423;

4. Superfamily c.150.1: EreA/ChaN-like [159501] (3 families)
   there are four conserved residues in the putative active site: two His and two Glu

5. Family c.150.1.3: EreA-like [159508] (2 proteins)
   Pfam PF05139; Erythromycin esterase-like; the superfamily core is decorated with insertion of a four-helical bundle and a C-terminal alpha+beta extension

6. Protein Succinoglycan biosynthesis protein BC3120 [159509] (1 species)

7. Species Bacillus cereus [TaxId:1396] [159510] (2 PDB entries)
   Uniprot Q81BN2 40-442

8. Domain d2radb_: 2rad B: [151822]
   automated match to d2rada1

Details for d2radb_

PDB Entry: 2rad, 2.75 Å

PDB Description: Crystal structure of the succinoglycan biosynthesis protein. Northeast structural Genomics Consortium target BcR135

PDB Compounds: (B:) Succinoglycan biosynthesis protein

SCOPe Domain Sequences for d2radb_:

Sequence; same for both SEQRES and ATOM records:

>d2radb_ c.150.1.3 (B:) Succinoglycan biosynthesis protein BC3120 {Bacillus cereus [TaxId: 1396]}
ntnqiakwleahakplkttnptaslndlkplknmvgsasivglgeathgahevftmkhri
vkylvsekgftnlvleegwdraleldryvltgkgnpsqhltpvfktkemldlldwirqyn
anpkhkskvrvigmdiqsvnenvynniieyikannskllprveekikglipvtkdmntfe
sltkeekekyvldaktisalleenksylngkskefawikqnariieqfttmlatppdkpa
dfylkhdiamyenakwteehlgktivwghnghvsktnmlsfiypkvagqhlaeyygkryv
sigtsvyegqynvknsdgefgpygtlksddpnsynyifgqvkkdqffidlrkangvtktw
lneqhpifagittegpdipktvdislgkafdilvqiqkvspsqvh

Timeline for d2radb_:

• d2radb_ first appeared in SCOP 1.75, called d2radb1
  
• d2radb_ appears in SCOPe 2.04
  
• d2radb_ appears in SCOPe 2.06
  
• d2radb_ appears in the current release, SCOPe 2.08