SCOP 1.75: Domain d2radb1: 2rad B:40-442

Lineage for d2radb1 (2rad B:40-442)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.150: EreA/ChaN-like [159500] (1 superfamily)
   Core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order:51423;

4. Superfamily c.150.1: EreA/ChaN-like [159501] (3 families)
   there are four conserved residues in the putative active site: two His and two Glu

5. Family c.150.1.3: EreA-like [159508] (2 proteins)
   Pfam PF05139; Erythromycin esterase-like; the superfamily core is decorated with insertion of a four-helical bundle and a C-terminal alpha+beta extension

6. Protein Succinoglycan biosynthesis protein BC3120 [159509] (1 species)

7. Species Bacillus cereus [TaxId:1396] [159510] (2 PDB entries)
   Uniprot Q81BN2 40-442

8. Domain d2radb1: 2rad B:40-442 [151822]
   automatically matched to 2RAD A:40-442

Details for d2radb1

PDB Entry: 2rad, 2.75 Å

PDB Description: Crystal structure of the succinoglycan biosynthesis protein. Northeast structural Genomics Consortium target BcR135

PDB Compounds: (B:) Succinoglycan biosynthesis protein

SCOP Domain Sequences for d2radb1:

Sequence; same for both SEQRES and ATOM records:

>d2radb1 c.150.1.3 (B:40-442) Succinoglycan biosynthesis protein BC3120 {Bacillus cereus [TaxId: 1396]}
nqiakwleahakplkttnptaslndlkplknmvgsasivglgeathgahevftmkhrivk
ylvsekgftnlvleegwdraleldryvltgkgnpsqhltpvfktkemldlldwirqynan
pkhkskvrvigmdiqsvnenvynniieyikannskllprveekikglipvtkdmntfesl
tkeekekyvldaktisalleenksylngkskefawikqnariieqfttmlatppdkpadf
ylkhdiamyenakwteehlgktivwghnghvsktnmlsfiypkvagqhlaeyygkryvsi
gtsvyegqynvknsdgefgpygtlksddpnsynyifgqvkkdqffidlrkangvtktwln
eqhpifagittegpdipktvdislgkafdilvqiqkvspsqvh

Timeline for d2radb1:

• d2radb1 is new in SCOP 1.75
  
• d2radb1 appears in SCOPe 2.01
  
• d2radb1 appears in the current release, SCOPe 2.08, called d2radb_