Lineage for d2radb_ (2rad B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923721Fold c.150: EreA/ChaN-like [159500] (1 superfamily)
    Core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order:51423;
  4. 2923722Superfamily c.150.1: EreA/ChaN-like [159501] (3 families) (S)
    there are four conserved residues in the putative active site: two His and two Glu
  5. 2923734Family c.150.1.3: EreA-like [159508] (2 proteins)
    Pfam PF05139; Erythromycin esterase-like; the superfamily core is decorated with insertion of a four-helical bundle and a C-terminal alpha+beta extension
  6. 2923735Protein Succinoglycan biosynthesis protein BC3120 [159509] (1 species)
  7. 2923736Species Bacillus cereus [TaxId:1396] [159510] (2 PDB entries)
    Uniprot Q81BN2 40-442
  8. 2923738Domain d2radb_: 2rad B: [151822]
    automated match to d2rada1

Details for d2radb_

PDB Entry: 2rad (more details), 2.75 Å

PDB Description: Crystal structure of the succinoglycan biosynthesis protein. Northeast structural Genomics Consortium target BcR135
PDB Compounds: (B:) Succinoglycan biosynthesis protein

SCOPe Domain Sequences for d2radb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2radb_ c.150.1.3 (B:) Succinoglycan biosynthesis protein BC3120 {Bacillus cereus [TaxId: 1396]}
ntnqiakwleahakplkttnptaslndlkplknmvgsasivglgeathgahevftmkhri
vkylvsekgftnlvleegwdraleldryvltgkgnpsqhltpvfktkemldlldwirqyn
anpkhkskvrvigmdiqsvnenvynniieyikannskllprveekikglipvtkdmntfe
sltkeekekyvldaktisalleenksylngkskefawikqnariieqfttmlatppdkpa
dfylkhdiamyenakwteehlgktivwghnghvsktnmlsfiypkvagqhlaeyygkryv
sigtsvyegqynvknsdgefgpygtlksddpnsynyifgqvkkdqffidlrkangvtktw
lneqhpifagittegpdipktvdislgkafdilvqiqkvspsqvh

SCOPe Domain Coordinates for d2radb_:

Click to download the PDB-style file with coordinates for d2radb_.
(The format of our PDB-style files is described here.)

Timeline for d2radb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2rada1