SCOPe 2.04: Domain d1mnkb_: 1mnk B:

Lineage for d1mnkb_ (1mnk B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)

8. Domain d1mnkb_: 1mnk B: [15182]
   complexed with hem

Details for d1mnkb_

PDB Entry: 1mnk, 2.2 Å

PDB Description: interactions among residues cd3, e7, e10 and e11 in myoglobins: attempts to simulate the o2 and co binding properties of aplysia myoglobin

PDB Compounds: (B:) Myoglobin

SCOPe Domain Sequences for d1mnkb_:

Sequence; same for both SEQRES and ATOM records:

>d1mnkb_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa) [TaxId: 9823]}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkvgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgf

Timeline for d1mnkb_:

• d1mnkb_ first appeared (with stable ids) in SCOP 1.55
  
• d1mnkb_ appears in SCOPe 2.03
  
• d1mnkb_ appears in SCOPe 2.05
  
• d1mnkb_ appears in the current release, SCOPe 2.08