Lineage for d1mnkb_ (1mnk B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531553Protein Myoglobin [46469] (9 species)
  7. 531584Species Pig (Sus scrofa) [TaxId:9823] [46473] (17 PDB entries)
  8. 531608Domain d1mnkb_: 1mnk B: [15182]
    complexed with hem; mutant

Details for d1mnkb_

PDB Entry: 1mnk (more details), 2.2 Å

PDB Description: interactions among residues cd3, e7, e10 and e11 in myoglobins: attempts to simulate the o2 and co binding properties of aplysia myoglobin

SCOP Domain Sequences for d1mnkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnkb_ a.1.1.2 (B:) Myoglobin {Pig (Sus scrofa)}
glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
lkkvgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamskalelfrndmaakykelgf

SCOP Domain Coordinates for d1mnkb_:

Click to download the PDB-style file with coordinates for d1mnkb_.
(The format of our PDB-style files is described here.)

Timeline for d1mnkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mnka_